Lineage for d5x1bd_ (5x1b D:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2577986Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 2577987Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 2578025Protein automated matches [190270] (1 species)
    not a true protein
  7. 2578026Species Cow (Bos taurus) [TaxId:9913] [187062] (25 PDB entries)
  8. 2578062Domain d5x1bd_: 5x1b D: [337660]
    Other proteins in same PDB: d5x1ba_, d5x1bb1, d5x1bb2, d5x1bc_, d5x1be_, d5x1bf_, d5x1bg_, d5x1bh_, d5x1bi_, d5x1bj_, d5x1bk_, d5x1bl_, d5x1bm_, d5x1bn_, d5x1bo1, d5x1bo2, d5x1bp_, d5x1br_, d5x1bs_, d5x1bt_, d5x1bu_, d5x1bv_, d5x1bw_, d5x1bx_, d5x1by_, d5x1bz_
    automated match to d1v54d_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d5x1bd_

PDB Entry: 5x1b (more details), 2.4 Å

PDB Description: co bound cytochrome c oxidase at 20 nsec after pump laser irradiation to release co from o2 reduction center
PDB Compounds: (D:) cytochrome c oxidase subunit 4 isoform 1, mitochondrial

SCOPe Domain Sequences for d5x1bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x1bd_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d5x1bd_:

Click to download the PDB-style file with coordinates for d5x1bd_.
(The format of our PDB-style files is described here.)

Timeline for d5x1bd_: