Lineage for d5l0rb_ (5l0r B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635893Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2636580Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2636581Protein automated matches [226968] (4 species)
    not a true protein
  7. 2636582Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)
  8. 2636583Domain d5l0rb_: 5l0r B: [337502]
    automated match to d1f7ea_
    complexed with ca, cl, gol, nag, udp

Details for d5l0rb_

PDB Entry: 5l0r (more details), 1.5 Å

PDB Description: human poglut1 in complex with notch1 egf12 and udp
PDB Compounds: (B:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d5l0rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l0rb_ g.3.11.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvnecvsnpcqndatcldqigefqcicmpgyegvhcevnt

SCOPe Domain Coordinates for d5l0rb_:

Click to download the PDB-style file with coordinates for d5l0rb_.
(The format of our PDB-style files is described here.)

Timeline for d5l0rb_: