PDB entry 5l0r

View 5l0r on RCSB PDB site
Description: human POGLUT1 in complex with Notch1 EGF12 and UDP
Class: transferase
Keywords: transferase glycosyltransferase GT-B glucosyltransferase, TRANSFERASE
Deposited on 2016-07-28, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein O-glucosyltransferase 1
  Species: Homo sapiens [TaxId:9606]
  Gene: POGLUT1, C3orf9, CLP46, KTELC1, MDSRP, MDS010, UNQ490/PRO1006
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8NBL1 (Start-356)
• Chain 'B':
  Compound: Neurogenic locus notch homolog protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: NOTCH1, TAN1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46531 (2-41)
  Domains in SCOPe 2.07: d5l0rb_
• Heterogens: NAG, UDP, GOL, CL, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >5l0rB (B:)
  gsdvnecvsnpcqndatcldqigefqcicmpgyegvhcevnt
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5l0rB (B:)
  dvnecvsnpcqndatcldqigefqcicmpgyegvhcevnt