SCOPe 2.06: Domain d5xl7d_: 5xl7 D:

Lineage for d5xl7d_ (5xl7 D:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (34 species)
   not a true protein

7. Species Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337305] (9 PDB entries)

8. Domain d5xl7d_: 5xl7 D: [337452]
   Other proteins in same PDB: d5xl7a_, d5xl7b_
   automated match to d4d00d_
   complexed with gal, nag, sia; mutant

Details for d5xl7d_

PDB Entry: 5xl7, 2.1 Å

PDB Description: the structure of hemagglutinin q226l mutant from an avian-origin h4n6 influenza virus in complex with human receptor analog lstc

PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d5xl7d_:

Sequence; same for both SEQRES and ATOM records:

>d5xl7d_ h.3.1.1 (D:) automated matches {Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

Timeline for d5xl7d_:

• d5xl7d_ is new in SCOPe 2.06-stable
  
• d5xl7d_ appears in SCOPe 2.07
  
• d5xl7d_ appears in the current release, SCOPe 2.08