Lineage for d5xl7d_ (5xl7 D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040926Species Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [346451] (9 PDB entries)
  8. 3040930Domain d5xl7d_: 5xl7 D: [337452]
    Other proteins in same PDB: d5xl7a_, d5xl7b_
    automated match to d4d00d_
    complexed with nag; mutant

Details for d5xl7d_

PDB Entry: 5xl7 (more details), 2.1 Å

PDB Description: the structure of hemagglutinin q226l mutant from an avian-origin h4n6 influenza virus in complex with human receptor analog lstc
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d5xl7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xl7d_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

SCOPe Domain Coordinates for d5xl7d_:

Click to download the PDB-style file with coordinates for d5xl7d_.
(The format of our PDB-style files is described here.)

Timeline for d5xl7d_: