SCOPe 2.06: Domain d5xlcc_: 5xlc C:

Lineage for d5xlcc_ (5xlc C:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (34 species)
   not a true protein

7. Species Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId:385590] [337305] (9 PDB entries)

8. Domain d5xlcc_: 5xlc C: [337314]
   Other proteins in same PDB: d5xlca_, d5xlcb_
   automated match to d4d00d_
   complexed with nag, sia; mutant

Details for d5xlcc_

PDB Entry: 5xlc, 2.4 Å

PDB Description: the structure of hemagglutinin q226l-g228s mutant from an avian-origin h4n6 influenza virus in complex with avian receptor analog lsta

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d5xlcc_:

Sequence; same for both SEQRES and ATOM records:

>d5xlcc_ h.3.1.1 (C:) automated matches {Influenza a virus (strain a/duck/czechoslovakia/1956 h4n6) [TaxId: 385590]}
glfgaiagfiengwqglidgwygfrhqnaegtgtaadlkstqaaidqingklnrliektn
dkyhqiekefeqvegriqdlekyvedtkidlwsynaellvalenqhtidvtdsemnklfe
rvrrqlrenaedkgngcfeifhkcdnnciesirngtydhdiyrdeainnrfq

Timeline for d5xlcc_:

• d5xlcc_ is new in SCOPe 2.06-stable
  
• d5xlcc_ appears in SCOPe 2.07
  
• d5xlcc_ appears in the current release, SCOPe 2.08