Lineage for d5thpo_ (5thp O:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500013Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2500014Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2500015Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2500166Protein automated matches [190060] (2 species)
    not a true protein
  7. 2500169Species Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries)
  8. 2500224Domain d5thpo_: 5thp O: [337255]
    Other proteins in same PDB: d5thpa_, d5thpb_, d5thpd_, d5thpe_, d5thpg_, d5thph_, d5thpj_, d5thpk_, d5thpm_, d5thpn_, d5thpp_, d5thpq_
    automated match to d1aoxb_
    complexed with cl, gol, mg, na, so4

Details for d5thpo_

PDB Entry: 5thp (more details), 3.01 Å

PDB Description: rhodocetin in complex with the integrin alpha2-a domain
PDB Compounds: (O:) Integrin alpha-2

SCOPe Domain Sequences for d5thpo_:

Sequence, based on SEQRES records: (download)

>d5thpo_ c.62.1.1 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntyk
tkeemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgs
mlkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaal
lekagtlgeqif

Sequence, based on observed residues (ATOM records): (download)

>d5thpo_ c.62.1.1 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqynnprvvfnlntykt
keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm
lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall
ekagtlgeqif

SCOPe Domain Coordinates for d5thpo_:

Click to download the PDB-style file with coordinates for d5thpo_.
(The format of our PDB-style files is described here.)

Timeline for d5thpo_: