Lineage for d1d5aa1 (1d5a A:1-347)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886496Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 2886638Species Desulfurococcus tok [TaxId:108142] [53130] (2 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold
  8. 2886639Domain d1d5aa1: 1d5a A:1-347 [33723]
    Other proteins in same PDB: d1d5aa2
    complexed with mg, so4
    has additional subdomain(s) that are not in the common domain

Details for d1d5aa1

PDB Entry: 1d5a (more details), 2.4 Å

PDB Description: crystal structure of an archaebacterial dna polymerase d.tok. deposition of second native structure at 2.4 angstrom
PDB Compounds: (A:) protein (DNA polymerase)

SCOPe Domain Sequences for d1d5aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5aa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Desulfurococcus tok [TaxId: 108142]}
mildadyitedgkpvirvfkkekgefkidydrdfepyiyallkddsaiedikkitaerhg
ttvrvtraervkkkflgrpvevwklyfthpqdvpairdkirehpavvdiyeydipfakry
lidrglipmegdeelrmlafdietlahagaaagagpilmisyadeegarvitwknidlpy
vesvstekemikrflkviqekdpdvlityngdnfdfaylkkrsemlgvkfilgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytletvyepvfgqpaekvyaeeiaeawa
sgeglervarysmedakatyelgkeffpmeaqlsrlvgqslwdvsrs

SCOPe Domain Coordinates for d1d5aa1:

Click to download the PDB-style file with coordinates for d1d5aa1.
(The format of our PDB-style files is described here.)

Timeline for d1d5aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d5aa2