SCOPe 2.08: Domain d1d5aa2: 1d5a A:348-756

Lineage for d1d5aa2 (1d5a A:348-756)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Family B DNA polymerase [56680] (7 species)

7. Species Desulfurococcus tok [TaxId:108142] [56684] (2 PDB entries)

8. Domain d1d5aa2: 1d5a A:348-756 [43012]
   Other proteins in same PDB: d1d5aa1
   complexed with mg, so4

Details for d1d5aa2

PDB Entry: 1d5a, 2.4 Å

PDB Description: crystal structure of an archaebacterial dna polymerase d.tok. deposition of second native structure at 2.4 angstrom

PDB Compounds: (A:) protein (DNA polymerase)

SCOPe Domain Sequences for d1d5aa2:

Sequence; same for both SEQRES and ATOM records:

>d1d5aa2 e.8.1.1 (A:348-756) Family B DNA polymerase {Desulfurococcus tok [TaxId: 108142]}
stgnlvewfllrkayerndvapnkpderelarrtesyaggyvkepekglwenivyldyks
lypsiiithnvspdtlnregcreydvapqvghrfckdfpgfipsllgdlleerqkvkkkm
katvdpierklldyrqraikilansyygyyayanarwycrecaesvtawgrqyiettmre
ieekfgfkvlyadtdgffatipgadaetvknkakeflnyinprlpglleleyegfyrrgf
fvtkkkyavideedkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevt
eklsrhevppeklviyeagphvaaaatvisyivlkgpgrvgdraipfdefdpakhrydae
yyienqvlpaverilrafgyrkedlr

Timeline for d1d5aa2:

• d1d5aa2 first appeared (with stable ids) in SCOP 1.55
  
• d1d5aa2 appears in SCOPe 2.07