Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (160 species) not a true protein |
Species Lactobacillus brevis [TaxId:1580] [337157] (1 PDB entry) |
Domain d5gp4c_: 5gp4 C: [337208] automated match to d1xeya_ complexed with plp |
PDB Entry: 5gp4 (more details), 2.16 Å
SCOPe Domain Sequences for d5gp4c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gp4c_ c.67.1.0 (C:) automated matches {Lactobacillus brevis [TaxId: 1580]} etlkpifgasaerhdlpkyklakhalepreadrlvrdqlldegnsrlnlatfcqtymepe avelmkdtleknaidkseyprtaeienrcvniianlwhapeaesftgtstigsseacmla glamkfawrkrakangldltahqpnivisagyqvcwekfcvywdidmhvvpmdddhmsln vdhvldyvddytigivgimgitytgqyddlarldavverynrttkfpvyihvdaasggfy tpfiepelkwdfrlnnvisinasghkyglvypgvgwviwrdqqylpkelvfkvsylggel ptmainfshsasqligqyynfirfgfdgyreiqekthdvarylaksltklggfslindgh elplicyeltadsdrewtlydlsdrllmkgwqvptyplpknmtdrviqrivvradfgmsm ahdfiddltqaihdldqah
Timeline for d5gp4c_: