Class a: All alpha proteins [46456] (289 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
Protein automated matches [190172] (9 species) not a true protein |
Species Leptospira interrogans [TaxId:173] [336977] (1 PDB entry) |
Domain d5kzla_: 5kzl A: [336978] automated match to d1ni6c_ complexed with hem |
PDB Entry: 5kzl (more details), 1.73 Å
SCOPe Domain Sequences for d5kzla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kzla_ a.132.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 173]} mslatilregtseehkaaessafirsfmkgilekgtyarhleafyyvyesmeeelernkn nlvlksiyfpelyrknalledlqffygtwkpndhqpsvatqdyvqrirkisetqpellaa hsyvrylgdlsggqilkkvaaralnlpegkgisfyefpmiqdingfkqnyrtaldslpvn dsekqsilaeskqvfllnqgifsel
Timeline for d5kzla_: