SCOPe 2.08: Domain d5kzla_: 5kzl A:

Lineage for d5kzla_ (5kzl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (9 species)
   not a true protein

7. Species Leptospira interrogans [TaxId:173] [336977] (1 PDB entry)

8. Domain d5kzla_: 5kzl A: [336978]
   automated match to d1ni6c_
   complexed with hem

Details for d5kzla_

PDB Entry: 5kzl, 1.73 Å

PDB Description: structure of heme oxygenase from leptospira interrogans

PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d5kzla_:

Sequence; same for both SEQRES and ATOM records:

>d5kzla_ a.132.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 173]}
mslatilregtseehkaaessafirsfmkgilekgtyarhleafyyvyesmeeelernkn
nlvlksiyfpelyrknalledlqffygtwkpndhqpsvatqdyvqrirkisetqpellaa
hsyvrylgdlsggqilkkvaaralnlpegkgisfyefpmiqdingfkqnyrtaldslpvn
dsekqsilaeskqvfllnqgifsel

Timeline for d5kzla_:

• d5kzla_ first appeared in SCOPe 2.06
  
• d5kzla_ appears in SCOPe 2.07