Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species) |
Species Thale cress (Arabidopsis thaliana), chloroplast [TaxId:3702] [142690] (12 PDB entries) Uniprot P69834 75-300 |
Domain d5mrma1: 5mrm A:76-299 [336814] Other proteins in same PDB: d5mrma2 automated match to d1w77a1 complexed with act, cd, k, q9t, trs |
PDB Entry: 5mrm (more details), 1.8 Å
SCOPe Domain Sequences for d5mrma1:
Sequence, based on SEQRES records: (download)
>d5mrma1 c.68.1.13 (A:76-299) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} eksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffrd ifeeyeesidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlk dgsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvkse glevtddvsiveylkhpvyvsqgsytnikvttpddlllaerils
>d5mrma1 c.68.1.13 (A:76-299) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} eksvsvillapkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeyeesidv dlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavgaavlg vpakatikevnsdslvvktktlwemqtpqvikpellkkgfelvkseglevtddvsiveyl khpvyvsqgsytnikvttpddlllaerils
Timeline for d5mrma1: