PDB entry 5mrm

View 5mrm on RCSB PDB site
Description: Arabidopsis thaliana IspD in complex with Isoxazole (4)
Class: transferase
Keywords: herbicide, anti-infectives, drug discovery, allosteric inhibition, transferase
Deposited on 2016-12-23, released 2017-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ISPD, MCT, MECT, MEPCT, At2g02500, T8K22.20
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69834 (1-End)
      • initiating methionine (0)
      • conflict (74)
    Domains in SCOPe 2.07: d5mrma1, d5mrma2
  • Heterogens: Q9T, TRS, ACT, K, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5mrmA (A:)
    meksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffr
    difeeyeesidvdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvl
    kdgsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvks
    eglevtddvsiveylkhpvyvsqgsytnikvttpddlllaerilseds
    

    Sequence, based on observed residues (ATOM records): (download)
    >5mrmA (A:)
    meksvsvillapkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeyeesid
    vdlsfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavgaavl
    gvpakatikevnsdslvvktktlwemqtpqvikpellkkgfelvkseglevtddvsivey
    lkhpvyvsqgsytnikvttpddlllaerils