SCOPe 2.08: Domain d5muaa2: 5mua A:149-286

Lineage for d5muaa2 (5mua A:149-286)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Polyporus squamosus [TaxId:5640] [233246] (2 PDB entries)

8. Domain d5muaa2: 5mua A:149-286 [336677]
   Other proteins in same PDB: d5muaa1, d5muab1
   automated match to d3phza2
   complexed with ca, dms, e64, gal

Details for d5muaa2

PDB Entry: 5mua, 1.49 Å

PDB Description: psl1a-e64 complex

PDB Compounds: (A:) Ricin B-related lectin

SCOPe Domain Sequences for d5muaa2:

Sequence; same for both SEQRES and ATOM records:

>d5muaa2 d.3.1.0 (A:149-286) automated matches {Polyporus squamosus [TaxId: 5640]}
lsqtganvhatllacpalrqdfksylsdglylvltrdqissiwqasglgstpwrseifdc
ddfatvfkgavakwgnenfkangfallcglmfgskssgahaynwfvergnfstvtffepq
ngtysanawdykayfglf

Timeline for d5muaa2:

• d5muaa2 first appeared in SCOPe 2.06
  
• d5muaa2 appears in SCOPe 2.07