Lineage for d5muaa2 (5mua A:149-286)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927640Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2927641Protein automated matches [190230] (23 species)
    not a true protein
  7. 2927818Species Polyporus squamosus [TaxId:5640] [233246] (2 PDB entries)
  8. 2927819Domain d5muaa2: 5mua A:149-286 [336677]
    Other proteins in same PDB: d5muaa1, d5muab1
    automated match to d3phza2
    complexed with ca, dms, e64, gal

Details for d5muaa2

PDB Entry: 5mua (more details), 1.49 Å

PDB Description: psl1a-e64 complex
PDB Compounds: (A:) Ricin B-related lectin

SCOPe Domain Sequences for d5muaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5muaa2 d.3.1.0 (A:149-286) automated matches {Polyporus squamosus [TaxId: 5640]}
lsqtganvhatllacpalrqdfksylsdglylvltrdqissiwqasglgstpwrseifdc
ddfatvfkgavakwgnenfkangfallcglmfgskssgahaynwfvergnfstvtffepq
ngtysanawdykayfglf

SCOPe Domain Coordinates for d5muaa2:

Click to download the PDB-style file with coordinates for d5muaa2.
(The format of our PDB-style files is described here.)

Timeline for d5muaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5muaa1