PDB entry 5mua

View 5mua on RCSB PDB site
Description: PSL1a-E64 complex
Class: sugar binding protein
Keywords: papain-like protease, E-64 inhibitor complex, lectin, calcium-binding, sugar binding protein
Deposited on 2017-01-12, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.49 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ricin B-related lectin
    Species: Polyporus squamosus [TaxId:5640]
    Gene: psl1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5muaa1, d5muaa2
  • Chain 'B':
    Compound: Ricin B-related lectin
    Species: Polyporus squamosus [TaxId:5640]
    Gene: psl1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5muab1, d5muab2
  • Heterogens: GAL, CA, E64, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5muaA (A:)
    msfqghgiyyiasayvantrlalsedssankspdviissdavdplnnlwliepvgeadty
    tvrnafagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtll
    ngdgggtgtvvgwqnitnntsqnwtfqklsqtganvhatllacpalrqdfksylsdglyl
    vltrdqissiwqasglgstpwrseifdcddfatvfkgavakwgnenfkangfallcglmf
    gskssgahaynwfvergnfstvtffepqngtysanawdykayfglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5muaA (A:)
    sfqghgiyyiasayvantrlalsespdviissdavdplnnlwliepvgeadtytvrnafa
    gsymdlaghaatdgtaiigyrptggdnqkwiisqwkiksketgtfvtllngtvvgwqnit
    nntsqnwtfqklsqtganvhatllacpalrqdfksylsdglylvltrdqissiwqasglg
    stpwrseifdcddfatvfkgavakwgnenfkangfallcglmfgskssgahaynwfverg
    nfstvtffepqngtysanawdykayfglf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5muaB (B:)
    msfqghgiyyiasayvantrlalsedssankspdviissdavdplnnlwliepvgeadty
    tvrnafagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtll
    ngdgggtgtvvgwqnitnntsqnwtfqklsqtganvhatllacpalrqdfksylsdglyl
    vltrdqissiwqasglgstpwrseifdcddfatvfkgavakwgnenfkangfallcglmf
    gskssgahaynwfvergnfstvtffepqngtysanawdykayfglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5muaB (B:)
    sfqghgiyyiasayvantrlalsedssankspdviissdavdplnnlwliepvgeadtyt
    vrnafagsymdlaghaatdgtaiigyrptggdnqkwiisqwkiksketgtfvtllngtvv
    gwqnitnntsqnwtfqklsqtganvhatllacpalrqdfksylsdglylvltrdqissiw
    qasglgstpwrseifdcddfatvfkgavakwgnenfkangfallcglmfgskssgahayn
    wfvergnfstvtffepqngtysanawdykayfglf