Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins) |
Protein Retroviral integrase, catalytic domain [53108] (3 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (21 PDB entries) |
Domain d1bl3c_: 1bl3 C: [33657] complexed with mg |
PDB Entry: 1bl3 (more details), 2 Å
SCOPe Domain Sequences for d1bl3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bl3c_ c.55.3.2 (C:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]} mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa ehlktavqmavfihnhkrkggiggysagerivdiiatdiq
Timeline for d1bl3c_: