SCOPe 2.03: Domain d1bl3c_: 1bl3 C:

Lineage for d1bl3c_ (1bl3 C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (37 PDB entries)

8. Domain d1bl3c_: 1bl3 C: [33657]
   complexed with mg

Details for d1bl3c_

PDB Entry: 1bl3, 2 Å

PDB Description: catalytic domain of hiv-1 integrase

PDB Compounds: (C:) integrase

SCOPe Domain Sequences for d1bl3c_:

Sequence; same for both SEQRES and ATOM records:

>d1bl3c_ c.55.3.2 (C:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
mhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwp
vktvhtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqa
ehlktavqmavfihnhkrkggiggysagerivdiiatdiq

Timeline for d1bl3c_:

• d1bl3c_ first appeared (with stable ids) in SCOP 1.55
  
• d1bl3c_ appears in SCOPe 2.02
  
• d1bl3c_ appears in SCOPe 2.04
  
• d1bl3c_ appears in the current release, SCOPe 2.08