SCOPe 2.08: Domain d5kozf1: 5koz F:1-138

Lineage for d5kozf1 (5koz F:1-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries)

8. Domain d5kozf1: 5koz F:1-138 [336502]
   Other proteins in same PDB: d5koza2, d5kozb2, d5kozc2, d5kozd2, d5koze2, d5kozf2, d5kozg2, d5kozh2, d5kozi2, d5kozj2, d5kozk2, d5kozl2
   automated match to d4lf2a1
   complexed with cap, co3, mg; mutant

Details for d5kozf1

PDB Entry: 5koz, 2.3 Å

PDB Description: structure function studies of r. palustris rubisco (k192c mutant; cabp-bound)

PDB Compounds: (F:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5kozf1:

Sequence; same for both SEQRES and ATOM records:

>d5kozf1 d.58.9.0 (F:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

Timeline for d5kozf1:

• d5kozf1 first appeared in SCOPe 2.06
  
• d5kozf1 appears in SCOPe 2.07