Lineage for d4lf2a1 (4lf2 A:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953229Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries)
  8. 2953241Domain d4lf2a1: 4lf2 A:1-138 [266659]
    Other proteins in same PDB: d4lf2a2, d4lf2b2, d4lf2c2, d4lf2d2, d4lf2e2, d4lf2f2
    automated match to d4lf1a1
    complexed with co3, mg, so4

Details for d4lf2a1

PDB Entry: 4lf2 (more details), 2.38 Å

PDB Description: hexameric form ii rubisco from rhodopseudomonas palustris, activated and complexed with sulfate and magnesium
PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d4lf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lf2a1 d.58.9.0 (A:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d4lf2a1:

Click to download the PDB-style file with coordinates for d4lf2a1.
(The format of our PDB-style files is described here.)

Timeline for d4lf2a1: