SCOPe 2.08: Domain d4lf2a1: 4lf2 A:1-138

Lineage for d4lf2a1 (4lf2 A:1-138)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
C-terminal domain is beta/alpha barrel
Family d.58.9.0: automated matches [227234] (1 protein)
not a true family
Protein automated matches [226983] (27 species)
not a true protein
Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries)
Domain d4lf2a1: 4lf2 A:1-138 [266659]
Other proteins in same PDB: d4lf2a2, d4lf2b2, d4lf2c2, d4lf2d2, d4lf2e2, d4lf2f2
automated match to d4lf1a1
complexed with co3, mg, so4

Details for d4lf2a1

PDB Entry: 4lf2 (more details), 2.38 Å

PDB Description: hexameric form ii rubisco from rhodopseudomonas palustris, activated and complexed with sulfate and magnesium

PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d4lf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lf2a1 d.58.9.0 (A:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d4lf2a1:

Click to download the PDB-style file with coordinates for d4lf2a1.
(The format of our PDB-style files is described here.)

Timeline for d4lf2a1: