![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) ![]() automatically mapped to Pfam PF00016 |
![]() | Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
![]() | Protein automated matches [226984] (16 species) not a true protein |
![]() | Species Rhodopseudomonas palustris [TaxId:258594] [257017] (3 PDB entries) |
![]() | Domain d4lf2c2: 4lf2 C:139-453 [266664] Other proteins in same PDB: d4lf2a1, d4lf2b1, d4lf2c1, d4lf2d1, d4lf2e1, d4lf2f1 automated match to d4lf1a2 complexed with co3, mg, so4 |
PDB Entry: 4lf2 (more details), 2.38 Å
SCOPe Domain Sequences for d4lf2c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lf2c2 c.1.14.1 (C:139-453) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf esfpqdadklypnwr
Timeline for d4lf2c2: