Lineage for d5koze2 (5koz E:139-455)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838900Species Rhodopseudomonas palustris [TaxId:258594] [257017] (3 PDB entries)
  8. 2838904Domain d5koze2: 5koz E:139-455 [336471]
    Other proteins in same PDB: d5koza1, d5kozb1, d5kozc1, d5kozd1, d5koze1, d5kozf1, d5kozg1, d5kozh1, d5kozi1, d5kozj1, d5kozk1, d5kozl1
    automated match to d4lf2a2
    complexed with cap, co3, mg; mutant

Details for d5koze2

PDB Entry: 5koz (more details), 2.3 Å

PDB Description: structure function studies of r. palustris rubisco (k192c mutant; cabp-bound)
PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5koze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5koze2 c.1.14.1 (E:139-455) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdficndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwrak

SCOPe Domain Coordinates for d5koze2:

Click to download the PDB-style file with coordinates for d5koze2.
(The format of our PDB-style files is described here.)

Timeline for d5koze2: