Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries) |
Domain d5kozj1: 5koz J:1-138 [336490] Other proteins in same PDB: d5koza2, d5kozb2, d5kozc2, d5kozd2, d5koze2, d5kozf2, d5kozg2, d5kozh2, d5kozi2, d5kozj2, d5kozk2, d5kozl2 automated match to d4lf2a1 complexed with cap, co3, mg; mutant |
PDB Entry: 5koz (more details), 2.3 Å
SCOPe Domain Sequences for d5kozj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kozj1 d.58.9.0 (J:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve yakmydfyvppaylklfd
Timeline for d5kozj1: