Lineage for d5kozg1 (5koz G:1-138)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) 
C-terminal domain is beta/alpha barrel
Family d.58.9.0: automated matches [227234] (1 protein)
not a true familyProtein automated matches [226983] (27 species)
not a true protein
Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries) 
Domain d5kozg1: 5koz G:1-138 [336475]
Other proteins in same PDB: d5koza2, d5kozb2, d5kozc2, d5kozd2, d5koze2, d5kozf2, d5kozg2, d5kozh2, d5kozi2, d5kozj2, d5kozk2, d5kozl2
automated match to d4lf2a1
complexed with cap, co3, mg; mutant
Details for d5kozg1
PDB Entry: 5koz (more details), 2.3 Å
PDB Description: structure function studies of r. palustris rubisco (k192c mutant; cabp-bound)
PDB Compounds: (G:) Ribulose bisphosphate carboxylaseSCOPe Domain Sequences for d5kozg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kozg1 d.58.9.0 (G:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd
SCOPe Domain Coordinates for d5kozg1:
Click to download the PDB-style file with coordinates for d5kozg1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5kozg1:
View in 3D
