Lineage for d1c0md2 (1c0m D:54-216)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 246267Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 246386Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)
  6. 246387Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 246421Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries)
  8. 246444Domain d1c0md2: 1c0m D:54-216 [33643]
    Other proteins in same PDB: d1c0ma1, d1c0mb1, d1c0mc1, d1c0md1
    mutant

Details for d1c0md2

PDB Entry: 1c0m (more details), 2.53 Å

PDB Description: crystal structure of rsv two-domain integrase

SCOP Domain Sequences for d1c0md2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0md2 c.55.3.2 (D:54-216) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrirvlaeg
dgfmkriptskqgellakamyalnhkergentktpiqkhwrpt

SCOP Domain Coordinates for d1c0md2:

Click to download the PDB-style file with coordinates for d1c0md2.
(The format of our PDB-style files is described here.)

Timeline for d1c0md2: