Lineage for d5vu4a1 (5vu4 A:11-325)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385894Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2385895Protein automated matches [227017] (57 species)
    not a true protein
  7. 2386104Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries)
  8. 2386123Domain d5vu4a1: 5vu4 A:11-325 [336426]
    Other proteins in same PDB: d5vu4a2, d5vu4b_, d5vu4c2, d5vu4d_, d5vu4e2, d5vu4f_
    automated match to d4xkga_
    complexed with bma, gal, man, nag, sia; mutant

Details for d5vu4a1

PDB Entry: 5vu4 (more details), 2.25 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225q/l226a mutant in complex with 6'-sln
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5vu4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vu4a1 b.19.1.0 (A:11-325) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrqassrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpe

SCOPe Domain Coordinates for d5vu4a1:

Click to download the PDB-style file with coordinates for d5vu4a1.
(The format of our PDB-style files is described here.)

Timeline for d5vu4a1: