Class b: All beta proteins [48724] (177 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (34 species) not a true protein |
Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (11 PDB entries) |
Domain d5vu4a1: 5vu4 A:11-325 [336426] Other proteins in same PDB: d5vu4a2, d5vu4b_, d5vu4c2, d5vu4d_, d5vu4e2, d5vu4f_ automated match to d4xkga_ complexed with bma, gal, man, nag, sia; mutant |
PDB Entry: 5vu4 (more details), 2.25 Å
SCOPe Domain Sequences for d5vu4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vu4a1 b.19.1.0 (A:11-325) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe qtslyvqasgrvtvstrrsqqtiipnigsrpwvrqassrisiywtivkpgdvlvinsngn liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk qntlklatgmrnvpe
Timeline for d5vu4a1: