SCOP 1.63: Domain d1vsh__: 1vsh -

Lineage for d1vsh__ (1vsh -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries)

8. Domain d1vsh__: 1vsh - [33633]
   complexed with epe, ocy, zn

Details for d1vsh__

PDB Entry: 1vsh, 1.95 Å

PDB Description: asv integrase core domain with zn(ii) cofactors

SCOP Domain Sequences for d1vsh__:

Sequence; same for both SEQRES and ATOM records:

>d1vsh__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf

Timeline for d1vsh__:

• d1vsh__ first appeared (with stable ids) in SCOP 1.55
  
• d1vsh__ appears in SCOP 1.61
  
• d1vsh__ appears in SCOP 1.65
  
• d1vsh__ appears in the current release, SCOPe 2.08, called d1vsha_