Lineage for d1a5w__ (1a5w -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) 
Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein) Protein Retroviral integrase, catalytic domain [53108] (3 species) Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries) 
Domain d1a5w__: 1a5w - [33632]
Details for d1a5w__
PDB Entry: 1a5w (more details), 2 Å
PDB Description: asv integrase core domain with hiv-1 integrase inhibitor y3
SCOP Domain Sequences for d1a5w__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a5w__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf
SCOP Domain Coordinates for d1a5w__:
Click to download the PDB-style file with coordinates for d1a5w__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a5w__:
- d1a5w__ first appeared (with stable ids) in SCOP 1.55
- d1a5w__ appears in SCOP 1.59
- d1a5w__ appears in SCOP 1.63
- d1a5w__ appears in the current release, SCOPe 2.08, called d1a5wa_
View in 3D