SCOP 1.61: Domain d1a5x__: 1a5x -

Lineage for d1a5x__ (1a5x -)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)

6. Protein Retroviral integrase, catalytic domain [53108] (3 species)

7. Species Rous sarcoma virus (RSV, avian sarcoma virus) [53109] (21 PDB entries)

8. Domain d1a5x__: 1a5x - [33630]

Details for d1a5x__

PDB Entry: 1a5x, 1.9 Å

PDB Description: asv integrase core domain with hiv-1 integrase inhibitor y3

SCOP Domain Sequences for d1a5x__:

Sequence; same for both SEQRES and ATOM records:

>d1a5x__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Rous sarcoma virus (RSV, avian sarcoma virus)}
glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlg
rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaeg
dgfmkriptskqgellakamyalnhf

Timeline for d1a5x__:

• d1a5x__ first appeared (with stable ids) in SCOP 1.55
  
• d1a5x__ appears in SCOP 1.59
  
• d1a5x__ appears in SCOP 1.63
  
• d1a5x__ appears in the current release, SCOPe 2.08, called d1a5xa_