Lineage for d1cxua_ (1cxu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886113Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
    Pfam PF00665
  6. 2886114Protein Retroviral integrase, catalytic domain [53108] (5 species)
  7. 2886245Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries)
  8. 2886249Domain d1cxua_: 1cxu A: [33624]
    complexed with cit, gol

Details for d1cxua_

PDB Entry: 1cxu (more details), 1.42 Å

PDB Description: 1.42a resolution asv integrase core domain from citrate
PDB Compounds: (A:) protein (avian sarcoma virus integrase)

SCOPe Domain Sequences for d1cxua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxua_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
gplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlgrp
kaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaegdg
fmkriptskqgellakamyalnh

SCOPe Domain Coordinates for d1cxua_:

Click to download the PDB-style file with coordinates for d1cxua_.
(The format of our PDB-style files is described here.)

Timeline for d1cxua_: