SCOPe 2.06: Domain d5km2b_: 5km2 B:

Lineage for d5km2b_ (5km2 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein automated matches [191082] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189791] (38 PDB entries)

8. Domain d5km2b_: 5km2 B: [336135]
   automated match to d3tw2a_
   complexed with c5p, cl, gol

Details for d5km2b_

PDB Entry: 5km2, 1.25 Å

PDB Description: human histidine triad nucleotide binding protein 1 (hhint1) cmp catalytic product complex

PDB Compounds: (B:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5km2b_:

Sequence; same for both SEQRES and ATOM records:

>d5km2b_ d.13.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesll
ghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

Timeline for d5km2b_:

• d5km2b_ is new in SCOPe 2.06-stable
  
• d5km2b_ appears in SCOPe 2.07
  
• d5km2b_ appears in the current release, SCOPe 2.08