SCOP 1.59: Domain d1hvuj1: 1hvu J:430-554

Lineage for d1hvuj1 (1hvu J:430-554)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (57 PDB entries)

8. Domain d1hvuj1: 1hvu J:430-554 [33603]
   Other proteins in same PDB: d1hvua2, d1hvub1, d1hvud2, d1hvue1, d1hvug2, d1hvuh1, d1hvuj2, d1hvuk1

Details for d1hvuj1

PDB Entry: 1hvu, 4.75 Å

PDB Description: human immunodeficiency virus type 1 reverse transcriptase complexed with a 33-base nucleotide rna pseudoknot

SCOP Domain Sequences for d1hvuj1:

Sequence; same for both SEQRES and ATOM records:

>d1hvuj1 c.55.3.1 (J:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d1hvuj1:

• d1hvuj1 first appeared (with stable ids) in SCOP 1.55
  
• d1hvuj1 appears in SCOP 1.57
  
• d1hvuj1 appears in SCOP 1.61
  
• d1hvuj1 appears in the current release, SCOPe 2.08