Lineage for d1hvuj1 (1hvu J:430-554)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25213Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 25218Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)
  7. 25219Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (41 PDB entries)
  8. 25266Domain d1hvuj1: 1hvu J:430-554 [33603]
    Other proteins in same PDB: d1hvua2, d1hvub1, d1hvud2, d1hvue1, d1hvug2, d1hvuh1, d1hvuj2, d1hvuk1

Details for d1hvuj1

PDB Entry: 1hvu (more details), 4.75 Å

PDB Description: human immunodeficiency virus type 1 reverse transcriptase complexed with a 33-base nucleotide rna pseudoknot

SCOP Domain Sequences for d1hvuj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvuj1 c.55.3.1 (J:430-554) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOP Domain Coordinates for d1hvuj1:

Click to download the PDB-style file with coordinates for d1hvuj1.
(The format of our PDB-style files is described here.)

Timeline for d1hvuj1: