SCOPe 2.07: Domain d5lo8a_: 5lo8 A:

Lineage for d5lo8a_ (5lo8 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein automated matches [190234] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (6 PDB entries)

8. Domain d5lo8a_: 5lo8 A: [335623]
   automated match to d3rpba_
   complexed with ca, gol, pio, so4

Details for d5lo8a_

PDB Entry: 5lo8, 2.5 Å

PDB Description: the c2b domain of rabphilin 3a in complex with pi(4,5)p2

PDB Compounds: (A:) rabphilin-3a

SCOPe Domain Sequences for d5lo8a_:

Sequence; same for both SEQRES and ATOM records:

>d5lo8a_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ergkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkpdmgkkakhktqik
kktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgisakgerlkhwy
eclknkdkkierwhqlqnen

Timeline for d5lo8a_:

• d5lo8a_ first appeared in SCOPe 2.06
  
• d5lo8a_ appears in the current release, SCOPe 2.08