Lineage for d5lo8a_ (5lo8 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2382505Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2382506Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2382667Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2382751Protein automated matches [190234] (2 species)
    not a true protein
  7. 2382758Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (6 PDB entries)
  8. 2382765Domain d5lo8a_: 5lo8 A: [335623]
    automated match to d3rpba_
    complexed with ca, gol, pio, so4

Details for d5lo8a_

PDB Entry: 5lo8 (more details), 2.5 Å

PDB Description: the c2b domain of rabphilin 3a in complex with pi(4,5)p2
PDB Compounds: (A:) rabphilin-3a

SCOPe Domain Sequences for d5lo8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lo8a_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ergkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkpdmgkkakhktqik
kktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgisakgerlkhwy
eclknkdkkierwhqlqnen

SCOPe Domain Coordinates for d5lo8a_:

Click to download the PDB-style file with coordinates for d5lo8a_.
(The format of our PDB-style files is described here.)

Timeline for d5lo8a_: