SCOPe 2.06: Domain d5n74f_: 5n74 F:

Lineage for d5n74f_ (5n74 F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)

7. Species Otolemur garnettii [TaxId:30611] [335375] (1 PDB entry)

8. Domain d5n74f_: 5n74 F: [335546]
   automated match to d1wu9a1

Details for d5n74f_

PDB Entry: 5n74, 2.3 Å

PDB Description: microtubule end binding protein complex

PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5n74f_:

Sequence; same for both SEQRES and ATOM records:

>d5n74f_ a.245.1.1 (F:) Microtubule-associated protein EB1, C-terminal dimerization domain {Otolemur garnettii [TaxId: 30611]}
lmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya

Timeline for d5n74f_:

• d5n74f_ is new in SCOPe 2.06-stable
  
• d5n74f_ appears in SCOPe 2.07
  
• d5n74f_ appears in the current release, SCOPe 2.08