Lineage for d5n74d_ (5n74 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020173Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2020174Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2020175Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 2020176Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)
  7. 2020198Species Otolemur garnettii [TaxId:30611] [335375] (1 PDB entry)
  8. 2020202Domain d5n74d_: 5n74 D: [335383]
    automated match to d1wu9a1

Details for d5n74d_

PDB Entry: 5n74 (more details), 2.3 Å

PDB Description: microtubule end binding protein complex
PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d5n74d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n74d_ a.245.1.1 (D:) Microtubule-associated protein EB1, C-terminal dimerization domain {Otolemur garnettii [TaxId: 30611]}
aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya

SCOPe Domain Coordinates for d5n74d_:

Click to download the PDB-style file with coordinates for d5n74d_.
(The format of our PDB-style files is described here.)

Timeline for d5n74d_: