SCOP 1.75: Domain d1f21a_: 1f21 A:

Lineage for d1f21a_ (1f21 A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (4 proteins)

6. Protein RNase H (RNase HI) [53100] (3 species)

7. Species Escherichia coli [TaxId:562] [53101] (30 PDB entries)
   Uniprot P0A7Y4

8. Domain d1f21a_: 1f21 A: [33550]
   mutant

Details for d1f21a_

PDB Entry: 1f21, 1.4 Å

PDB Description: divalent metal cofactor binding in the kinetic folding trajectory of e. coli ribonuclease hi

PDB Compounds: (A:) ribonuclease hi

SCOP Domain Sequences for d1f21a_:

Sequence; same for both SEQRES and ATOM records:

>d1f21a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]}
kqveiftdgsalgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealkeh
aevilstdsqyvrqgitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwewvk
ghaghpeneradelaraaamnptledtgyqve

Timeline for d1f21a_:

• d1f21a_ first appeared (with stable ids) in SCOP 1.55
  
• d1f21a_ appears in SCOP 1.73
  
• d1f21a_ appears in SCOPe 2.01
  
• d1f21a_ appears in the current release, SCOPe 2.08