SCOPe 2.08: Domain d5nnrb_: 5nnr B:

Lineage for d5nnrb_ (5nnr B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:209285] [335423] (1 PDB entry)

8. Domain d5nnrb_: 5nnr B: [335424]
   automated match to d4kvme_

Details for d5nnrb_

PDB Entry: 5nnr, 3.1 Å

PDB Description: structure of naa15/naa10 bound to hypk-thb

PDB Compounds: (B:) Naa10

SCOPe Domain Sequences for d5nnrb_:

Sequence; same for both SEQRES and ATOM records:

>d5nnrb_ d.108.1.0 (B:) automated matches {Chaetomium thermophilum [TaxId: 209285]}
mdirllrpsdipliqhanlenlpenyflkyylyhalswpqlsfvavdvsrpakspydypk
ivgyvlakmeeepadgvphghitslsvmrthrrlgiaeklmrqsqlamvetynahyvslh
vrvsnkaaihlyrdtlgfktekveakyyadgedaycmkldltalreqiaaqreke

Timeline for d5nnrb_:

• d5nnrb_ first appeared in SCOPe 2.06
  
• d5nnrb_ appears in SCOPe 2.07