Lineage for d5n28c_ (5n28 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561884Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2562016Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 2562017Protein automated matches [227074] (5 species)
    not a true protein
  7. 2562028Species Methanotorris formicicus [TaxId:647171] [335373] (2 PDB entries)
  8. 2562030Domain d5n28c_: 5n28 C: [335384]
    Other proteins in same PDB: d5n28b2, d5n28e2
    automated match to d1e6yc_
    complexed with com, f43, k, tp7

Details for d5n28c_

PDB Entry: 5n28 (more details), 2.8 Å

PDB Description: methyl-coenzyme m reductase iii from methanotorris formicicus monoclinic form
PDB Compounds: (C:) Methyl-coenzyme M reductase, gamma subunit

SCOPe Domain Sequences for d5n28c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n28c_ d.58.31.0 (C:) automated matches {Methanotorris formicicus [TaxId: 647171]}
ykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihppleem
dlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtlsg
rqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryvyd
ektghvvyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkrih
rartlggfcptedtfkql

SCOPe Domain Coordinates for d5n28c_:

Click to download the PDB-style file with coordinates for d5n28c_.
(The format of our PDB-style files is described here.)

Timeline for d5n28c_: