Lineage for d5n28e2 (5n28 E:189-444)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332765Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2332766Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2332848Family a.89.1.0: automated matches [227272] (1 protein)
    not a true family
  6. 2332849Protein automated matches [227075] (5 species)
    not a true protein
  7. 2332858Species Methanotorris formicicus [TaxId:647171] [335416] (2 PDB entries)
  8. 2332860Domain d5n28e2: 5n28 E:189-444 [335417]
    Other proteins in same PDB: d5n28b1, d5n28c_, d5n28e1, d5n28f_
    automated match to d1hbnb1
    complexed with com, f43, k, tp7

Details for d5n28e2

PDB Entry: 5n28 (more details), 2.8 Å

PDB Description: methyl-coenzyme m reductase iii from methanotorris formicicus monoclinic form
PDB Compounds: (E:) Methyl-coenzyme M reductase, beta subunit

SCOPe Domain Sequences for d5n28e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n28e2 a.89.1.0 (E:189-444) automated matches {Methanotorris formicicus [TaxId: 647171]}
gyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllglayqglna
dnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdvakwnayaa
aglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgfsffshsiy
ggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavfsaidefre
plkyvidgalavkdki

SCOPe Domain Coordinates for d5n28e2:

Click to download the PDB-style file with coordinates for d5n28e2.
(The format of our PDB-style files is described here.)

Timeline for d5n28e2: