Lineage for d5mwba1 (5mwb A:415-456)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258773Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2258774Protein automated matches [226968] (4 species)
    not a true protein
  7. 2258775Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries)
  8. 2258790Domain d5mwba1: 5mwb A:415-456 [335365]
    automated match to d1toza1
    complexed with bgc, ca, fuc, xyp

Details for d5mwba1

PDB Entry: 5mwb (more details), 1.86 Å

PDB Description: human notch-2 egf11-13
PDB Compounds: (A:) Neurogenic locus notch homolog protein 2

SCOPe Domain Sequences for d5mwba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mwba1 g.3.11.0 (A:415-456) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvdecamansnpcehagkcvntdgafhceclkgyagprcemd

SCOPe Domain Coordinates for d5mwba1:

Click to download the PDB-style file with coordinates for d5mwba1.
(The format of our PDB-style files is described here.)

Timeline for d5mwba1: