PDB entry 5mwb

View 5mwb on RCSB PDB site
Description: Human Notch-2 EGF11-13
Class: signaling protein
Keywords: EGF, Notch, receptor, signaling, signaling protein
Deposited on 2017-01-18, released 2017-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurogenic locus notch homolog protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NOTCH2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5mwba1, d5mwba2, d5mwba3
  • Heterogens: BGC, XYP, FUC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5mwbA (A:)
edvdecamansnpcehagkcvntdgafhceclkgyagprcemdinechsdpcqndatcld
kiggftclcmpgfkgvhceleinecqsnpcvnngqcvdkvnrfqclcppgftgpvcqidg
sglevlfqgpgslhhildaqkmvwnhrghhhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >5mwbA (A:)
dvdecamansnpcehagkcvntdgafhceclkgyagprcemdinechsdpcqndatcldk
iggftclcmpgfkgvhceleinecqsnpcvnngqcvdkvnrfqclcppgftgpvcqid