Lineage for d5iiaa_ (5iia A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987085Fold a.19: Fertilization protein [47081] (1 superfamily)
    core: 3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1987086Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
    automatically mapped to Pfam PF01303
  5. 1987087Family a.19.1.1: Fertilization protein [47083] (3 proteins)
  6. 1987088Protein Lysin [47084] (2 species)
  7. 1987092Species Red abalone (Haliotis rufescens) [TaxId:6454] [47085] (6 PDB entries)
  8. 1987096Domain d5iiaa_: 5iia A: [335357]
    automated match to d2lisa_
    complexed with nag

Details for d5iiaa_

PDB Entry: 5iia (more details), 1.7 Å

PDB Description: crystal structure of red abalone egg verl repeat 3 in complex with sperm lysin at 1.7 a resolution (crystal form i)
PDB Compounds: (A:) Egg-lysin

SCOPe Domain Sequences for d5iiaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iiaa_ a.19.1.1 (A:) Lysin {Red abalone (Haliotis rufescens) [TaxId: 6454]}
flnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlwi
nkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpadv
pvkym

SCOPe Domain Coordinates for d5iiaa_:

Click to download the PDB-style file with coordinates for d5iiaa_.
(The format of our PDB-style files is described here.)

Timeline for d5iiaa_: