Class a: All alpha proteins [46456] (289 folds) |
Fold a.19: Fertilization protein [47081] (1 superfamily) core: 3 helices; bundle, closed, right-handed twist; up-and-down |
Superfamily a.19.1: Fertilization protein [47082] (1 family) automatically mapped to Pfam PF01303 |
Family a.19.1.1: Fertilization protein [47083] (3 proteins) |
Protein Lysin [47084] (2 species) |
Species Red abalone (Haliotis rufescens) [TaxId:6454] [47085] (6 PDB entries) |
Domain d2lisa_: 2lis A: [16405] |
PDB Entry: 2lis (more details), 1.35 Å
SCOPe Domain Sequences for d2lisa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lisa_ a.19.1.1 (A:) Lysin {Red abalone (Haliotis rufescens) [TaxId: 6454]} hyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwa nymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinr mrpadvpvkym
Timeline for d2lisa_: