Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (21 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [335084] (2 PDB entries) |
Domain d5nd6b2: 5nd6 B:388-579 [335212] Other proteins in same PDB: d5nd6a3, d5nd6b3 automated match to d1itza2 complexed with edo |
PDB Entry: 5nd6 (more details), 1.58 Å
SCOPe Domain Sequences for d5nd6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nd6b2 c.36.1.0 (B:388-579) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} lpenweaalphfkpedkglatrqhsqtminalapalpgliggsadlapsnltlmkisgdf qkgsyaernlrfgvrehamgaicngialhksglipycatfyiftdymrnamrmsalseag vvyvmthdsiglgedgpthqpiehlasframpdmlmirpaggnetagaykvaianrkrpt tialsrqnmpni
Timeline for d5nd6b2: