SCOPe 2.08: Domain d5nd6a2: 5nd6 A:388-579

Lineage for d5nd6a2 (5nd6 A:388-579)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [335084] (2 PDB entries)

8. Domain d5nd6a2: 5nd6 A:388-579 [335087]
   Other proteins in same PDB: d5nd6a3, d5nd6b3
   automated match to d1itza2
   complexed with edo

Details for d5nd6a2

PDB Entry: 5nd6, 1.58 Å

PDB Description: crystal structure of apo transketolase from chlamydomonas reinhardtii

PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5nd6a2:

Sequence; same for both SEQRES and ATOM records:

>d5nd6a2 c.36.1.0 (A:388-579) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
lpenweaalphfkpedkglatrqhsqtminalapalpgliggsadlapsnltlmkisgdf
qkgsyaernlrfgvrehamgaicngialhksglipycatfyiftdymrnamrmsalseag
vvyvmthdsiglgedgpthqpiehlasframpdmlmirpaggnetagaykvaianrkrpt
tialsrqnmpni

Timeline for d5nd6a2:

• d5nd6a2 first appeared in SCOPe 2.06
  
• d5nd6a2 appears in SCOPe 2.07