SCOPe 2.08: Domain d5nd6b3: 5nd6 B:580-718

Lineage for d5nd6b3 (5nd6 B:580-718)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.0: automated matches [227237] (1 protein)
   not a true family

6. Protein automated matches [226991] (9 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [335088] (2 PDB entries)

8. Domain d5nd6b3: 5nd6 B:580-718 [335213]
   Other proteins in same PDB: d5nd6a1, d5nd6a2, d5nd6b1, d5nd6b2
   automated match to d1itza3
   complexed with edo

Details for d5nd6b3

PDB Entry: 5nd6, 1.58 Å

PDB Description: crystal structure of apo transketolase from chlamydomonas reinhardtii

PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d5nd6b3:

Sequence; same for both SEQRES and ATOM records:

>d5nd6b3 c.48.1.0 (B:580-718) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
pncsvegvakgaytihdtkagvkpdvilmgtgselelataaagilekegknvrvvsfpcw
elfeeqsaeykesvlpsdvtarvsveaatsfgwakyiglkgkhvgidtfgasapaptlye
kfgitvnhvveaakatlqh

Timeline for d5nd6b3:

• d5nd6b3 first appeared in SCOPe 2.06
  
• d5nd6b3 appears in SCOPe 2.07