SCOPe 2.07: Domain d5tuwb2: 5tuw B:174-311

Lineage for d5tuwb2 (5tuw B:174-311)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
Superfamily d.17.4: NTF2-like [54427] (31 families)
has a beta-alpha(2)-beta insertion after the main helix
Family d.17.4.0: automated matches [191337] (1 protein)
not a true family
Protein automated matches [190205] (33 species)
not a true protein
Species Synechocystis sp. [TaxId:1111708] [275032] (5 PDB entries)
Domain d5tuwb2: 5tuw B:174-311 [335184]
Other proteins in same PDB: d5tuwa1, d5tuwb1, d5tuwc1, d5tuwd1, d5tuwe1, d5tuwf1
automated match to d1m98a2
complexed with eq3, gol

Details for d5tuwb2

PDB Entry: 5tuw (more details), 2.3 Å

PDB Description: crystal structure of orange carotenoid protein with partial loss of 3'oh echinenone chromophore

PDB Compounds: (B:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5tuwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tuwb2 d.17.4.0 (B:174-311) automated matches {Synechocystis sp. [TaxId: 1111708]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspke

SCOPe Domain Coordinates for d5tuwb2:

Click to download the PDB-style file with coordinates for d5tuwb2.
(The format of our PDB-style files is described here.)

Timeline for d5tuwb2: