Lineage for d1glfx2 (1glf X:254-500)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 
Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) 
Family c.55.1.4: Glycerol kinase [53089] (1 protein) Protein Glycerol kinase [53090] (1 species) Species Escherichia coli [TaxId:562] [53091] (12 PDB entries) 
Domain d1glfx2: 1glf X:254-500 [33512]
Details for d1glfx2
PDB Entry: 1glf (more details), 2.62 Å
PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation
SCOP Domain Sequences for d1glfx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1glfx2 c.55.1.4 (X:254-500) Glycerol kinase {Escherichia coli}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweehd
SCOP Domain Coordinates for d1glfx2:
Click to download the PDB-style file with coordinates for d1glfx2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1glfx2:
View in 3D
